Promospro.com

Promospro.com has Server used 50.23.151.215 IP Address with Hostname in United States. Below listing website ranking, Similar Webs, Backlinks. This domain was first 2015-09-09 (2 years, 13 days) and hosted in Seattle United States, server ping response time 106 ms

DNS & Emails Contact

This tool is used to extract the DNS and Emails from this domain uses to contact the customer.

Fetching Emails ...

Extract All Emails from Domain

Top Keywords Suggestions

Keywords suggestion tool used Promospro keyword to suggest some keywords related from this domain. If you want more, you can press button Load more »

1 Promospro
2 Promosport
3 Promospro review
4 Promopro
5 Promopro coupons
6 Promo products
7 Promospot
8 Promos pros
9 Promo pros

Hosting Provider

Website: Promospro.com
Hostname: d7.97.1732.ip4.static.sl-reverse.com
Country:
Region: WA
City: Seattle
Postal Code: 98111
Latitude: 47.
Longitude: -455
Area Code: 206
Email AbuseNo Emails Found

Listing Websites Same Server

We Found 1 Websites on 50.23.151.215 IP Address in United States

Find Other Domains on Any IP/ Domain


New! Domain Extensions Updated .com .org .de .net .uk » more ...

Domains Actived Recently

Eternityrose.com (8 seconds ago)

Hpcwire.com (20 seconds ago)

Readydebitgold.com (20 seconds ago)

Dynamix.net (12 seconds ago)

Mergetool.com (10 seconds ago)

Picsuk.com (7 seconds ago)

Happywheelsy8.com (4 seconds ago)

Otukenim.org (45 seconds ago)

Patiosoft.com (32 seconds ago)

Discountramps.com (1 seconds ago)

Yusp.com (21 seconds ago)

Redboxasia.com (16 seconds ago)

Farmtofeet.com (13 seconds ago)

Craftsyhelp.com (14 seconds ago)

Polymerlogistics.com (8 seconds ago)

Yunbaokj.com (3 seconds ago)

Victoryonly.com (34 seconds ago)

Ttxunhuan.com (2 seconds ago)

Pcvark.com (6 seconds ago)

Results For Websites Listing

Found 56 Websites with content related to this domain, It is result after search with search engine

PromosPro: the Best Gift Ideas, Daily Hot Deals and …

/>

Promospro.com

Free Shipping Coupons

/>

Promospro.com

Living a Frugal Lifestyle with PromosPro US | Find …

/>

Blog.promospro.com

Promo Pro Inc - Promotional Products & Apparel - Home

/>

Promoproinc.com

Miller Promotional Products

/>

Thepromopro.com

PromoPro () | Twitter

/>

Twitter.com

Fame and Partners - Official Site

/>

Fameandpartners.com

Promospro.com - PromosPro: Online Coupons, Promo …

/>

Minify.mobi

Branding Your Business Increases Sales–Promotions Pronto

/>

Promospronto.com

Promopros

/>

Promopros.com

Twitter

/>

Twitter.com

Searches related

Recently Analyzed Sites


Related pages


amerisourcebergen passport portal loginopenseesame loginaspen nksdmyess kmmg usamy utest loginqpay company portalosha amerscdoitright pepboysadp pwrcsms ocps loginparent connection aisd loginfcso.org bookings and releasesgp tools rappmpusd parent portalexamone techview 360emsi enationesales stihlvisit activate.tjxrewards.comhr portal cappstraderjoesdayforcehcmpaperless employee chicago park districtthe original suburpiasra.cn.ca extranetmcso us paidsmartfind express sbcssslb secure gatewaynps vf imagewearmybjc orgstiga eurotek ping pong tableweb1and1 loginmy math wsu edudms.umuc.eduacfederal netmsi instructureunitek college student portal loginffr intas pharmaimmi eservicessmms oakvillepatta chitta fonttextfree pinger helpfvz moodlewebnetzerocentral genesishccgo greystar portalhfd employee self servicemyfirstpremiercreditcardwww bwwb orgwv tailgate central message boardsutter healthstreamejatt comloteriaflkrowd longhorncslplasma.com balancefca teamnetinfodirect tcawalnet2sycamore education 2226gander mountain trailhead websitehr expresswaystudiosak bagstenneco benefits centerparentvue cusd200ags theatre omr show timingsemp my pulsermoms englewoodlc engineering coupon codewww adhqrewards commy mcckc blackboardwcc blackboard sunypiedmont rosterappsveracross spazumiez employee loginthe givens kidstcpt loginportal4me