Internationalinsurance.org

Internationalinsurance.org has Server used 45.56.109.51 IP Address with Hostname in United States. Below listing website ranking, Similar Webs, Backlinks. This domain was first 1999-11-12 (17 years, 347 days) and hosted in Newark United States, server ping response time 40 ms

DNS & Emails Contact

This tool is used to extract the DNS and Emails from this domain uses to contact the customer.

Fetching Emails ...

Extract All Emails from Domain

Top Keywords Suggestions

Keywords suggestion tool used Internationalinsurance keyword to suggest some keywords related from this domain. If you want more, you can press button Load more »

1 International insurance company
2 International insurance
3 International insurance agency
4 International insurance coverage
5 International insurance group
6 International insurance reviews
7 International insurance professionals
8 International insurance anthem
9 International insurance brokers

Hosting Provider

Website: Internationalinsurance.org
Hostname: li911-51.members.linode.com
Country:
Region: NJ
City: Newark
Postal Code: 07102
Latitude: 40.
Longitude: -74.
Area Code: 973
Email AbuseNo Emails Found

Listing Websites Same Server

We Found 1 Websites on 45.56.109.51 IP Address in United States

Find Other Domains on Any IP/ Domain


New! Domain Extensions Updated .com .org .de .net .uk » more ...

Domains Actived Recently

Hdpagalworld.com (11 day ago)

Seshires.com (11 day ago)

Bilgimak.net (11 day ago)

Yelp.com (11 day ago)

Eyecatchyinfo.com (11 day ago)

Nmra.org (11 day ago)

Viconsortium.com (11 day ago)

Mt.gov (11 day ago)

Axuer.com (11 day ago)

Hmco.com (11 day ago)

Thisisbitten.com (11 day ago)

Jimdo.com (11 day ago)

Xiaoyi.com (11 day ago)

Thisissand.com (11 day ago)

Snugjazz.com (11 day ago)

Alltdesign.com (11 day ago)

Blogdon.net (11 day ago)

Results For Websites Listing

Found 50 Websites with content related to this domain, It is result after search with search engine

International Insurance - coming back soon

/>

Internationalinsurance.org

International Travel Insurance Group - Health and …

/>

Internationalinsurance.com

International Travel Insurance - Global Travel Insurance …

/>

Internationalinsurance.com

International Health Insurance - Medical Insurance …

/>

Ehealthinsurance.com

Aetna International | International Health Insurance for

/>

Aetnainternational.com

International Insurance Fact Book 2017 | III

/>

Iii.org

International Insurance | Aetna

/>

Aetna.com

Compare International Health Insurance Online | Major Compare

/>

Majorcompare.com

International Insurance - Thum Insurance Agency, LLC

/>

Thuminsurance.com

International Insurance Center, Inc. - Top Local General

/>

Iic.cc

Freebase

/>

Freebase.com

LinkedIn

/>

Linkedin.com

Freebase

/>

Freebase.com

Recently Analyzed Sites


Related pages


www nidc ircitytime loginnavtrak loginmywipro wipro comfarenga funeral home allerton avesupportdesk activantkelly estubvport teacher logingolflink com promo codeuceusa logingeha provider logindealer reyreyfyjs bbsalcoa hewitt resourcesbreslau manorbeimeishengqianwangattelinkmyseaport loginumass quikpayrps205 parent portalmtcd2lmy knowledgespring comwsib eservicewebmail ghc orgdcps.mygradeportalumdnj.edu loginguineeinformation rtgadecco paperless payharlingen tstc webadvisorhttps mig avera orggoantiquing net dealer loginisd 194 schoologylinn benton tractor silvertonwww.myactv.net webmaildelta controls passportwww myfrontier orgcoach intersourcing loginwww ahmchealth essbenefits cominfobank acs inc commyoduportalwww.myhr4u.comacosta portal loginebrdi paragon mls loginucdavismycharttec inetbillerfoxridge resident portaldomaindiscover loginmylan jive loginikya pay portalwhelan security ehubwupatient wustl eduuws sona systemsgoqforce comdoubanyinyueunigroup skillport comefacts brevard clerk of courtsa2ctp emscchamberlain portal loginerbb message boardsourcenet slehchef works coupon codemylabattwyolotto winning numbersncat manage my idbooling urban dictionarywqkt school closingpaperlesspay talx aerotekilearn fronterkeiseruniversity.blackboard.commatrix mls hawaiisipad skopjecostco vendor extranet loginmyinfo reyesholding com vic